Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709
  1. Avatar for lange 121. lange Lv 1 1 pt. 9,071
  2. Avatar for ehhan2018 122. ehhan2018 Lv 1 1 pt. 9,069
  3. Avatar for aspadistra 123. aspadistra Lv 1 1 pt. 8,943
  4. Avatar for ti_go_Mars 124. ti_go_Mars Lv 1 1 pt. 8,938
  5. Avatar for andromeda72 125. andromeda72 Lv 1 1 pt. 8,938
  6. Avatar for _VoiD_ 126. _VoiD_ Lv 1 1 pt. 8,937
  7. Avatar for dataco79 127. dataco79 Lv 1 1 pt. 8,893
  8. Avatar for HeLa 128. HeLa Lv 1 1 pt. 8,863
  9. Avatar for skiller185 129. skiller185 Lv 1 1 pt. 8,852
  10. Avatar for felixxy 130. felixxy Lv 1 1 pt. 8,845

Comments