Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 72 pts. 9,740
  2. Avatar for jausmh 12. jausmh Lv 1 69 pts. 9,738
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 67 pts. 9,737
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 64 pts. 9,736
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 62 pts. 9,735
  6. Avatar for MicElephant 16. MicElephant Lv 1 60 pts. 9,732
  7. Avatar for Phyx 17. Phyx Lv 1 58 pts. 9,731
  8. Avatar for cbwest 18. cbwest Lv 1 56 pts. 9,731
  9. Avatar for orily1337 19. orily1337 Lv 1 54 pts. 9,730
  10. Avatar for robgee 20. robgee Lv 1 52 pts. 9,728

Comments