Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709
  1. Avatar for pvc78 61. pvc78 Lv 1 9 pts. 9,612
  2. Avatar for Flagg65a 62. Flagg65a Lv 1 8 pts. 9,584
  3. Avatar for altejoh 63. altejoh Lv 1 8 pts. 9,571
  4. Avatar for Anfinsen_slept_here 64. Anfinsen_slept_here Lv 1 7 pts. 9,565
  5. Avatar for Cagdason 65. Cagdason Lv 1 7 pts. 9,559
  6. Avatar for ManVsYard 66. ManVsYard Lv 1 7 pts. 9,552
  7. Avatar for Hugeen 67. Hugeen Lv 1 6 pts. 9,552
  8. Avatar for poiuytrewq987 68. poiuytrewq987 Lv 1 6 pts. 9,549
  9. Avatar for tarimo 69. tarimo Lv 1 6 pts. 9,542
  10. Avatar for Idiotboy 70. Idiotboy Lv 1 5 pts. 9,519

Comments