Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for ironchefnorse 111. ironchefnorse Lv 1 1 pt. 9,218
  2. Avatar for Idiotboy 112. Idiotboy Lv 1 1 pt. 9,186
  3. Avatar for XyberX 113. XyberX Lv 1 1 pt. 9,185
  4. Avatar for alwan2018 114. alwan2018 Lv 1 1 pt. 9,123
  5. Avatar for Lyshi2018 115. Lyshi2018 Lv 1 1 pt. 9,094
  6. Avatar for mkq 116. mkq Lv 1 1 pt. 8,984
  7. Avatar for OdysseasVro 117. OdysseasVro Lv 1 1 pt. 8,914
  8. Avatar for Graham MF 118. Graham MF Lv 1 1 pt. 8,871
  9. Avatar for Philippe_C 119. Philippe_C Lv 1 1 pt. 8,824
  10. Avatar for dbuske 120. dbuske Lv 1 1 pt. 8,795

Comments