Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,651
  2. Avatar for reefyrob 2. reefyrob Lv 1 97 pts. 10,544
  3. Avatar for crpainter 3. crpainter Lv 1 94 pts. 10,533
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 91 pts. 10,502
  5. Avatar for Galaxie 5. Galaxie Lv 1 88 pts. 10,474
  6. Avatar for Phyx 6. Phyx Lv 1 85 pts. 10,474
  7. Avatar for spvincent 7. spvincent Lv 1 82 pts. 10,416
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 79 pts. 10,379
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 76 pts. 10,379
  10. Avatar for grogar7 10. grogar7 Lv 1 73 pts. 10,353

Comments