Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for TastyMunchies 11. TastyMunchies Lv 1 71 pts. 10,334
  2. Avatar for Deleted player 12. Deleted player pts. 10,323
  3. Avatar for toshiue 13. toshiue Lv 1 66 pts. 10,316
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 63 pts. 10,314
  5. Avatar for jeff101 15. jeff101 Lv 1 61 pts. 10,310
  6. Avatar for actiasluna 16. actiasluna Lv 1 59 pts. 10,291
  7. Avatar for Anfinsen_slept_here 17. Anfinsen_slept_here Lv 1 56 pts. 10,281
  8. Avatar for Blipperman 18. Blipperman Lv 1 54 pts. 10,279
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 52 pts. 10,260
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 50 pts. 10,252

Comments