Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 15 pts. 10,468
  2. Avatar for Deleted player 12. Deleted player pts. 10,460
  3. Avatar for lamoille 13. lamoille Lv 1 9 pts. 10,454
  4. Avatar for jermainiac 14. jermainiac Lv 1 7 pts. 10,443
  5. Avatar for alwen 15. alwen Lv 1 5 pts. 10,442
  6. Avatar for alcor29 16. alcor29 Lv 1 4 pts. 10,436
  7. Avatar for monteecristo 17. monteecristo Lv 1 3 pts. 10,413
  8. Avatar for phi16 18. phi16 Lv 1 2 pts. 10,398
  9. Avatar for timroberts16 19. timroberts16 Lv 1 2 pts. 10,392
  10. Avatar for Anfinsen_slept_here 20. Anfinsen_slept_here Lv 1 1 pt. 10,384

Comments