Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for actiasluna 21. actiasluna Lv 1 1 pt. 10,379
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 1 pt. 10,366
  3. Avatar for Deleted player 23. Deleted player pts. 10,364
  4. Avatar for Blipperman 24. Blipperman Lv 1 1 pt. 10,361
  5. Avatar for Sissue 25. Sissue Lv 1 1 pt. 10,347
  6. Avatar for ManVsYard 26. ManVsYard Lv 1 1 pt. 10,334
  7. Avatar for Phyx 27. Phyx Lv 1 1 pt. 10,265
  8. Avatar for Aminal88 28. Aminal88 Lv 1 1 pt. 10,248
  9. Avatar for dbuske 29. dbuske Lv 1 1 pt. 10,145
  10. Avatar for Maerlyn138 30. Maerlyn138 Lv 1 1 pt. 10,137

Comments