Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups


  1. Avatar for Beta Folders 100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992

  1. Avatar for mariusunterwasser 141. mariusunterwasser Lv 1 1 pt. 5,319
  2. Avatar for 01010011111 142. 01010011111 Lv 1 1 pt. 0
  3. Avatar for lamoille 143. lamoille Lv 1 1 pt. 0
  4. Avatar for Hollinas 144. Hollinas Lv 1 1 pt. 0
  5. Avatar for jflat06 146. jflat06 Lv 1 1 pt. 0
  6. Avatar for Jagro2019 147. Jagro2019 Lv 1 1 pt. 0

Comments