Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for TastyMunchies 11. TastyMunchies Lv 1 71 pts. 10,334
  2. Avatar for Deleted player 12. Deleted player pts. 10,323
  3. Avatar for toshiue 13. toshiue Lv 1 66 pts. 10,316
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 63 pts. 10,314
  5. Avatar for jeff101 15. jeff101 Lv 1 61 pts. 10,310
  6. Avatar for actiasluna 16. actiasluna Lv 1 59 pts. 10,291
  7. Avatar for Anfinsen_slept_here 17. Anfinsen_slept_here Lv 1 56 pts. 10,281
  8. Avatar for Blipperman 18. Blipperman Lv 1 54 pts. 10,279
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 52 pts. 10,260
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 50 pts. 10,252

Comments