Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,000
  2. Avatar for phi16 2. phi16 Lv 1 79 pts. 10,995
  3. Avatar for lamoille 3. lamoille Lv 1 61 pts. 10,966
  4. Avatar for alcor29 4. alcor29 Lv 1 47 pts. 10,960
  5. Avatar for alwen 5. alwen Lv 1 35 pts. 10,958
  6. Avatar for robgee 6. robgee Lv 1 26 pts. 10,958
  7. Avatar for hansvandenhof 7. hansvandenhof Lv 1 19 pts. 10,849
  8. Avatar for LociOiling 8. LociOiling Lv 1 14 pts. 10,836
  9. Avatar for reefyrob 9. reefyrob Lv 1 10 pts. 10,834
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 7 pts. 10,833

Comments