Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697

  1. Avatar for robgee
    1. robgee Lv 1
    100 pts. 10,984
  2. Avatar for Aubade01 2. Aubade01 Lv 1 97 pts. 10,980
  3. Avatar for grogar7 3. grogar7 Lv 1 93 pts. 10,935
  4. Avatar for LociOiling 4. LociOiling Lv 1 89 pts. 10,848
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 86 pts. 10,848
  6. Avatar for O Seki To 6. O Seki To Lv 1 83 pts. 10,846
  7. Avatar for Marvelz 7. Marvelz Lv 1 79 pts. 10,834
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 76 pts. 10,831
  9. Avatar for tyler0911 9. tyler0911 Lv 1 73 pts. 10,830
  10. Avatar for reefyrob 10. reefyrob Lv 1 70 pts. 10,827

Comments