Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310
  1. Avatar for lihong13101049 111. lihong13101049 Lv 1 1 pt. 9,366
  2. Avatar for Squirrely 112. Squirrely Lv 1 1 pt. 9,334
  3. Avatar for cenkonur 113. cenkonur Lv 1 1 pt. 9,310
  4. Avatar for Ref_Jo 114. Ref_Jo Lv 1 1 pt. 9,305
  5. Avatar for Hellcat6 115. Hellcat6 Lv 1 1 pt. 9,287
  6. Avatar for lihong670920 116. lihong670920 Lv 1 1 pt. 9,283
  7. Avatar for IssaG 117. IssaG Lv 1 1 pt. 9,282
  8. Avatar for chloebborromeo 118. chloebborromeo Lv 1 1 pt. 9,253
  9. Avatar for lamoille 119. lamoille Lv 1 1 pt. 9,189
  10. Avatar for Sunmurder 120. Sunmurder Lv 1 1 pt. 9,117

Comments