Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310

  1. Avatar for nicobul 11. nicobul Lv 1 67 pts. 10,817
  2. Avatar for Galaxie 12. Galaxie Lv 1 65 pts. 10,805
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 62 pts. 10,799
  4. Avatar for johnmitch 14. johnmitch Lv 1 59 pts. 10,767
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 57 pts. 10,760
  6. Avatar for silent gene 16. silent gene Lv 1 54 pts. 10,759
  7. Avatar for phi16 17. phi16 Lv 1 52 pts. 10,752
  8. Avatar for fpc 18. fpc Lv 1 50 pts. 10,744
  9. Avatar for jobo0502 19. jobo0502 Lv 1 48 pts. 10,740
  10. Avatar for crpainter 20. crpainter Lv 1 46 pts. 10,736

Comments