Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for Deleted player 11. Deleted player pts. 10,807
  2. Avatar for toshiue 12. toshiue Lv 1 3 pts. 10,765
  3. Avatar for Maerlyn138 13. Maerlyn138 Lv 1 2 pts. 10,744
  4. Avatar for DodoBird 14. DodoBird Lv 1 1 pt. 10,721
  5. Avatar for Hollinas 15. Hollinas Lv 1 1 pt. 10,720
  6. Avatar for timroberts16 16. timroberts16 Lv 1 1 pt. 10,720
  7. Avatar for silent gene 17. silent gene Lv 1 1 pt. 10,714
  8. Avatar for ManVsYard 18. ManVsYard Lv 1 1 pt. 10,680
  9. Avatar for dbuske 19. dbuske Lv 1 1 pt. 10,636
  10. Avatar for Blipperman 20. Blipperman Lv 1 1 pt. 10,603

Comments