Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Contenders 11. Contenders 3 pts. 9,784
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 9,413
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,238
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,072
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,015
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,862
  7. Avatar for dTech Biology 2018-2019 17. dTech Biology 2018-2019 1 pt. 7,464
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,054
  9. Avatar for freefolder 19. freefolder 1 pt. 5,961
  10. Avatar for MBB190 20. MBB190 1 pt. 5,295
  1. Avatar for Technetium 111. Technetium Lv 1 1 pt. 6,153
  2. Avatar for Deleted player 112. Deleted player pts. 5,966
  3. Avatar for Altercomp 113. Altercomp Lv 1 1 pt. 5,961
  4. Avatar for Cipo 114. Cipo Lv 1 1 pt. 5,851
  5. Avatar for SiPot2018 115. SiPot2018 Lv 1 1 pt. 5,813
  6. Avatar for alwan2018 116. alwan2018 Lv 1 1 pt. 5,471
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 5,461
  8. Avatar for Dorwan1889 118. Dorwan1889 Lv 1 1 pt. 5,399
  9. Avatar for reejoeman 119. reejoeman Lv 1 1 pt. 5,295
  10. Avatar for cenkonur 120. cenkonur Lv 1 1 pt. 4,982

Comments