Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 10,647
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 10,531
  3. Avatar for tyler0911 3. tyler0911 Lv 1 93 pts. 10,364
  4. Avatar for grogar7 4. grogar7 Lv 1 90 pts. 10,302
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 87 pts. 10,211
  6. Avatar for jausmh 6. jausmh Lv 1 84 pts. 10,199
  7. Avatar for LociOiling 7. LociOiling Lv 1 81 pts. 10,156
  8. Avatar for pvc78 8. pvc78 Lv 1 78 pts. 10,133
  9. Avatar for frood66 9. frood66 Lv 1 75 pts. 10,130
  10. Avatar for jobo0502 10. jobo0502 Lv 1 72 pts. 10,093

Comments