Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups


  1. Avatar for Contenders 11. Contenders 3 pts. 9,784
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 9,413
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,238
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,072
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,015
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,862
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,054
  8. Avatar for freefolder 19. freefolder 1 pt. 5,961
  9. Avatar for MBB190 20. MBB190 1 pt. 5,295

  1. Avatar for protein.plus 131. protein.plus Lv 1 1 pt. 0
  2. Avatar for ehhan2018 132. ehhan2018 Lv 1 1 pt. 0
  3. Avatar for spvincent 133. spvincent Lv 1 1 pt. 0
  4. Avatar for lamoille 134. lamoille Lv 1 1 pt. 0
  5. Avatar for Marc1028 135. Marc1028 Lv 1 1 pt. 0
  6. Avatar for DodoBird 136. DodoBird Lv 1 1 pt. 0
  7. Avatar for Hollinas 137. Hollinas Lv 1 1 pt. 0
  8. Avatar for Marvelz 139. Marvelz Lv 1 1 pt. 0

Comments