Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,555
  2. Avatar for grogar7 2. grogar7 Lv 1 83 pts. 10,523
  3. Avatar for phi16 3. phi16 Lv 1 68 pts. 10,472
  4. Avatar for robgee 4. robgee Lv 1 55 pts. 10,471
  5. Avatar for lamoille 5. lamoille Lv 1 44 pts. 10,471
  6. Avatar for alwen 6. alwen Lv 1 35 pts. 10,464
  7. Avatar for Deleted player 7. Deleted player pts. 10,456
  8. Avatar for alcor29 8. alcor29 Lv 1 21 pts. 10,440
  9. Avatar for LociOiling 9. LociOiling Lv 1 16 pts. 10,247
  10. Avatar for orily1337 10. orily1337 Lv 1 12 pts. 10,184

Comments