Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878

  1. Avatar for DodoBird 131. DodoBird Lv 1 1 pt. 0
  2. Avatar for Hollinas 132. Hollinas Lv 1 1 pt. 0
  3. Avatar for protein.plus 134. protein.plus Lv 1 1 pt. 0
  4. Avatar for Marc1028 135. Marc1028 Lv 1 1 pt. 0
  5. Avatar for Marvelz 136. Marvelz Lv 1 1 pt. 0
  6. Avatar for spvincent 137. spvincent Lv 1 1 pt. 0
  7. Avatar for lamoille 138. lamoille Lv 1 1 pt. 0
  8. Avatar for ehhan2018 139. ehhan2018 Lv 1 1 pt. 0

Comments