Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878

  1. Avatar for actiasluna 11. actiasluna Lv 1 69 pts. 10,089
  2. Avatar for Deleted player 12. Deleted player pts. 10,081
  3. Avatar for Vinara 13. Vinara Lv 1 64 pts. 10,078
  4. Avatar for reefyrob 14. reefyrob Lv 1 61 pts. 10,075
  5. Avatar for Deleted player 15. Deleted player pts. 10,018
  6. Avatar for alwen 16. alwen Lv 1 57 pts. 10,007
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 55 pts. 10,004
  8. Avatar for robgee 18. robgee Lv 1 52 pts. 9,979
  9. Avatar for Blipperman 19. Blipperman Lv 1 50 pts. 9,978
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 48 pts. 9,950

Comments