Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365
  1. Avatar for lamoille 141. lamoille Lv 1 1 pt. 6,488
  2. Avatar for 181818 142. 181818 Lv 1 1 pt. 6,488

Comments