Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365
  1. Avatar for LociOiling 11. LociOiling Lv 1 70 pts. 10,115
  2. Avatar for crpainter 12. crpainter Lv 1 67 pts. 10,115
  3. Avatar for pvc78 13. pvc78 Lv 1 65 pts. 10,106
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 62 pts. 10,103
  5. Avatar for grogar7 15. grogar7 Lv 1 60 pts. 10,102
  6. Avatar for DoctorSockrates 16. DoctorSockrates Lv 1 57 pts. 10,100
  7. Avatar for O Seki To 17. O Seki To Lv 1 55 pts. 10,094
  8. Avatar for Anfinsen_slept_here 18. Anfinsen_slept_here Lv 1 53 pts. 10,091
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 51 pts. 10,090
  10. Avatar for jobo0502 20. jobo0502 Lv 1 49 pts. 10,089

Comments