Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365
  1. Avatar for LociOiling 11. LociOiling Lv 1 70 pts. 10,115
  2. Avatar for crpainter 12. crpainter Lv 1 67 pts. 10,115
  3. Avatar for pvc78 13. pvc78 Lv 1 65 pts. 10,106
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 62 pts. 10,103
  5. Avatar for grogar7 15. grogar7 Lv 1 60 pts. 10,102
  6. Avatar for DoctorSockrates 16. DoctorSockrates Lv 1 57 pts. 10,100
  7. Avatar for O Seki To 17. O Seki To Lv 1 55 pts. 10,094
  8. Avatar for Anfinsen_slept_here 18. Anfinsen_slept_here Lv 1 53 pts. 10,091
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 51 pts. 10,090
  10. Avatar for jobo0502 20. jobo0502 Lv 1 49 pts. 10,089

Comments