Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365
  1. Avatar for Cloudy_Tiger 71. Cloudy_Tiger Lv 1 4 pts. 9,775
  2. Avatar for vizhu2018 72. vizhu2018 Lv 1 4 pts. 9,769
  3. Avatar for Crossed Sticks 73. Crossed Sticks Lv 1 3 pts. 9,768
  4. Avatar for joaniegirl 74. joaniegirl Lv 1 3 pts. 9,766
  5. Avatar for heather-1 75. heather-1 Lv 1 3 pts. 9,748
  6. Avatar for Alpha-KetoGlutarate1301 76. Alpha-KetoGlutarate1301 Lv 1 3 pts. 9,723
  7. Avatar for lconor 77. lconor Lv 1 3 pts. 9,711
  8. Avatar for roman madala 78. roman madala Lv 1 2 pts. 9,705
  9. Avatar for UnderPowered 79. UnderPowered Lv 1 2 pts. 9,704
  10. Avatar for kludbrook 80. kludbrook Lv 1 2 pts. 9,688

Comments