Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,568
  2. Avatar for freefolder 12. freefolder 2 pts. 9,361
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,192
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,798
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,723
  6. Avatar for MBB190 16. MBB190 1 pt. 8,111
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,345
  8. Avatar for I3L GANG 19. I3L GANG 1 pt. 6,991
  9. Avatar for Deleted group 20. Deleted group pts. 2,801

  1. Avatar for Museka 41. Museka Lv 1 24 pts. 10,149
  2. Avatar for fpc 42. fpc Lv 1 24 pts. 10,083
  3. Avatar for cbwest 43. cbwest Lv 1 23 pts. 10,076
  4. Avatar for diamonddays 44. diamonddays Lv 1 22 pts. 10,015
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 21 pts. 10,005
  6. Avatar for stomjoh 46. stomjoh Lv 1 20 pts. 10,001
  7. Avatar for smilingone 47. smilingone Lv 1 19 pts. 9,960
  8. Avatar for toshiue 48. toshiue Lv 1 18 pts. 9,913
  9. Avatar for alwen 49. alwen Lv 1 18 pts. 9,808
  10. Avatar for phi16 50. phi16 Lv 1 17 pts. 9,783

Comments