Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684
  1. Avatar for Museka 41. Museka Lv 1 24 pts. 10,149
  2. Avatar for fpc 42. fpc Lv 1 24 pts. 10,083
  3. Avatar for cbwest 43. cbwest Lv 1 23 pts. 10,076
  4. Avatar for diamonddays 44. diamonddays Lv 1 22 pts. 10,015
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 21 pts. 10,005
  6. Avatar for stomjoh 46. stomjoh Lv 1 20 pts. 10,001
  7. Avatar for smilingone 47. smilingone Lv 1 19 pts. 9,960
  8. Avatar for toshiue 48. toshiue Lv 1 18 pts. 9,913
  9. Avatar for alwen 49. alwen Lv 1 18 pts. 9,808
  10. Avatar for phi16 50. phi16 Lv 1 17 pts. 9,783

Comments