Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684
  1. Avatar for rkulim26 131. rkulim26 Lv 1 1 pt. 7,004
  2. Avatar for disafear 132. disafear Lv 1 1 pt. 7,004
  3. Avatar for benz888 133. benz888 Lv 1 1 pt. 6,991
  4. Avatar for dvgf 134. dvgf Lv 1 1 pt. 6,960
  5. Avatar for DipsyDoodle2016 135. DipsyDoodle2016 Lv 1 1 pt. 6,931
  6. Avatar for mcguevara 136. mcguevara Lv 1 1 pt. 6,869
  7. Avatar for aresescul 137. aresescul Lv 1 1 pt. 6,840
  8. Avatar for IssaG 138. IssaG Lv 1 1 pt. 6,839
  9. Avatar for larry25427 139. larry25427 Lv 1 1 pt. 6,836
  10. Avatar for janikavillamor 140. janikavillamor Lv 1 1 pt. 6,826

Comments