Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684
  1. Avatar for Amphimixus 101. Amphimixus Lv 1 1 pt. 8,359
  2. Avatar for agcantos 102. agcantos Lv 1 1 pt. 8,281
  3. Avatar for hajtogato 103. hajtogato Lv 1 1 pt. 8,236
  4. Avatar for IHGreenman 104. IHGreenman Lv 1 1 pt. 8,170
  5. Avatar for candicetambaoan 105. candicetambaoan Lv 1 1 pt. 8,164
  6. Avatar for chloebborromeo 106. chloebborromeo Lv 1 1 pt. 8,151
  7. Avatar for reejoeman 107. reejoeman Lv 1 1 pt. 8,111
  8. Avatar for Anamfija 108. Anamfija Lv 1 1 pt. 8,096
  9. Avatar for nadinelim 109. nadinelim Lv 1 1 pt. 8,081
  10. Avatar for altejoh 110. altejoh Lv 1 1 pt. 8,063

Comments