Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684

  1. Avatar for Phyx 11. Phyx Lv 1 73 pts. 10,457
  2. Avatar for robgee 12. robgee Lv 1 71 pts. 10,428
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 68 pts. 10,426
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 66 pts. 10,421
  5. Avatar for reefyrob 15. reefyrob Lv 1 64 pts. 10,415
  6. Avatar for nicobul 16. nicobul Lv 1 62 pts. 10,405
  7. Avatar for frood66 17. frood66 Lv 1 60 pts. 10,354
  8. Avatar for vakobo 18. vakobo Lv 1 58 pts. 10,344
  9. Avatar for silent gene 19. silent gene Lv 1 56 pts. 10,344
  10. Avatar for MicElephant 20. MicElephant Lv 1 54 pts. 10,320

Comments