Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,397
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,394
  3. Avatar for freefolder 13. freefolder 2 pts. 9,155
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,137
  5. Avatar for GENE 433 15. GENE 433 1 pt. 8,963
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,911
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,833
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 8,745
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 7,732
  10. Avatar for MBB190 20. MBB190 1 pt. 7,559
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,792
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 97 pts. 9,763
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 9,718
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 9,716
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 89 pts. 9,711
  6. Avatar for grogar7 6. grogar7 Lv 1 86 pts. 9,702
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 83 pts. 9,700
  8. Avatar for Phyx 8. Phyx Lv 1 81 pts. 9,699
  9. Avatar for actiasluna 9. actiasluna Lv 1 78 pts. 9,690
  10. Avatar for Galaxie 10. Galaxie Lv 1 76 pts. 9,673

Comments