Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups



  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,792
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 97 pts. 9,763
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 9,718
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 9,716
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 89 pts. 9,711
  6. Avatar for grogar7 6. grogar7 Lv 1 86 pts. 9,702
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 83 pts. 9,700
  8. Avatar for Phyx 8. Phyx Lv 1 81 pts. 9,699
  9. Avatar for actiasluna 9. actiasluna Lv 1 78 pts. 9,690
  10. Avatar for Galaxie 10. Galaxie Lv 1 76 pts. 9,673

Comments