Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,397
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,394
  3. Avatar for freefolder 13. freefolder 2 pts. 9,155
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,137
  5. Avatar for GENE 433 15. GENE 433 1 pt. 8,963
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,911
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,833
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 8,745
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 7,732
  10. Avatar for MBB190 20. MBB190 1 pt. 7,559
  1. Avatar for lconor 91. lconor Lv 1 2 pts. 8,962
  2. Avatar for Vmou 92. Vmou Lv 1 2 pts. 8,961
  3. Avatar for cobaltteal 93. cobaltteal Lv 1 2 pts. 8,943
  4. Avatar for ourtown 94. ourtown Lv 1 2 pts. 8,924
  5. Avatar for toshiue 95. toshiue Lv 1 2 pts. 8,915
  6. Avatar for aspadistra 96. aspadistra Lv 1 2 pts. 8,911
  7. Avatar for fearjuan 97. fearjuan Lv 1 2 pts. 8,906
  8. Avatar for nadinelim 98. nadinelim Lv 1 2 pts. 8,899
  9. Avatar for Knoblerine 99. Knoblerine Lv 1 1 pt. 8,888
  10. Avatar for Pawel Tluscik 100. Pawel Tluscik Lv 1 1 pt. 8,886

Comments