Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups



  1. Avatar for memam2018 101. memam2018 Lv 1 1 pt. 8,867
  2. Avatar for alwan2018 102. alwan2018 Lv 1 1 pt. 8,855
  3. Avatar for JasperD 103. JasperD Lv 1 1 pt. 8,833
  4. Avatar for rinze 104. rinze Lv 1 1 pt. 8,817
  5. Avatar for Auntecedent 105. Auntecedent Lv 1 1 pt. 8,817
  6. Avatar for candicetambaoan 106. candicetambaoan Lv 1 1 pt. 8,796
  7. Avatar for jamiexq 107. jamiexq Lv 1 1 pt. 8,791
  8. Avatar for agcantos 108. agcantos Lv 1 1 pt. 8,785
  9. Avatar for Zainul0103 109. Zainul0103 Lv 1 1 pt. 8,745
  10. Avatar for Dantoto 110. Dantoto Lv 1 1 pt. 8,739

Comments