Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups



  1. Avatar for rol 111. rol Lv 1 1 pt. 8,732
  2. Avatar for harvardman 112. harvardman Lv 1 1 pt. 8,687
  3. Avatar for jeremiasivan 113. jeremiasivan Lv 1 1 pt. 8,686
  4. Avatar for Arne Heessels 114. Arne Heessels Lv 1 1 pt. 8,660
  5. Avatar for keik 115. keik Lv 1 1 pt. 8,605
  6. Avatar for hajtogato 116. hajtogato Lv 1 1 pt. 8,553
  7. Avatar for vizhu2018 117. vizhu2018 Lv 1 1 pt. 8,533
  8. Avatar for Jrothenberg 118. Jrothenberg Lv 1 1 pt. 8,523
  9. Avatar for rkulim26 119. rkulim26 Lv 1 1 pt. 8,518
  10. Avatar for janikavillamor 120. janikavillamor Lv 1 1 pt. 8,508

Comments