Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups



  1. Avatar for Willyanto 131. Willyanto Lv 1 1 pt. 8,084
  2. Avatar for ayyu 132. ayyu Lv 1 1 pt. 8,074
  3. Avatar for felixxy 133. felixxy Lv 1 1 pt. 8,055
  4. Avatar for roman madala 134. roman madala Lv 1 1 pt. 8,043
  5. Avatar for ZRGanapin 135. ZRGanapin Lv 1 1 pt. 8,023
  6. Avatar for nong9090 136. nong9090 Lv 1 1 pt. 8,010
  7. Avatar for takashiyamanaka 137. takashiyamanaka Lv 1 1 pt. 7,849
  8. Avatar for IssaG 138. IssaG Lv 1 1 pt. 7,829
  9. Avatar for asiachong 139. asiachong Lv 1 1 pt. 7,815
  10. Avatar for mrcabotage 140. mrcabotage Lv 1 1 pt. 7,814

Comments