Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups



  1. Avatar for diamonddays 51. diamonddays Lv 1 16 pts. 9,333
  2. Avatar for heather-1 52. heather-1 Lv 1 16 pts. 9,292
  3. Avatar for Idiotboy 53. Idiotboy Lv 1 15 pts. 9,292
  4. Avatar for Alistair69 54. Alistair69 Lv 1 14 pts. 9,284
  5. Avatar for jtrube1 55. jtrube1 Lv 1 14 pts. 9,254
  6. Avatar for abiogenesis 56. abiogenesis Lv 1 13 pts. 9,233
  7. Avatar for alcor29 57. alcor29 Lv 1 12 pts. 9,233
  8. Avatar for thewholeblahthing 58. thewholeblahthing Lv 1 12 pts. 9,223
  9. Avatar for ManVsYard 59. ManVsYard Lv 1 11 pts. 9,218
  10. Avatar for traal 60. traal Lv 1 11 pts. 9,212

Comments