Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,293
  2. Avatar for NECC Anatomy and Physiology 22. NECC Anatomy and Physiology 1 pt. 5,351
  1. Avatar for dd-2 61. dd-2 Lv 1 10 pts. 9,205
  2. Avatar for Merf 62. Merf Lv 1 10 pts. 9,203
  3. Avatar for Marvelz 63. Marvelz Lv 1 9 pts. 9,179
  4. Avatar for kludbrook 64. kludbrook Lv 1 9 pts. 9,176
  5. Avatar for martin.kendig@verizon.net 65. martin.kendig@verizon.net Lv 1 9 pts. 9,166
  6. Avatar for benrh 66. benrh Lv 1 8 pts. 9,162
  7. Avatar for Altercomp 67. Altercomp Lv 1 8 pts. 9,155
  8. Avatar for Hellcat6 68. Hellcat6 Lv 1 7 pts. 9,148
  9. Avatar for zanbato 69. zanbato Lv 1 7 pts. 9,146
  10. Avatar for jausmh 70. jausmh Lv 1 7 pts. 9,141

Comments