Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for parsnip 91. parsnip Lv 1 1 pt. 8,715
  2. Avatar for Pawel Tluscik 92. Pawel Tluscik Lv 1 1 pt. 8,710
  3. Avatar for zanbato 93. zanbato Lv 1 1 pt. 8,705
  4. Avatar for momadoc 94. momadoc Lv 1 1 pt. 8,638
  5. Avatar for felixxy 95. felixxy Lv 1 1 pt. 8,617
  6. Avatar for ourtown 96. ourtown Lv 1 1 pt. 8,580
  7. Avatar for JSmith48 97. JSmith48 Lv 1 1 pt. 8,519
  8. Avatar for diamonddays 98. diamonddays Lv 1 1 pt. 8,515
  9. Avatar for Amphimixus 99. Amphimixus Lv 1 1 pt. 8,483
  10. Avatar for rol 100. rol Lv 1 1 pt. 8,440

Comments