Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for jmb23 111. jmb23 Lv 1 1 pt. 7,212
  2. Avatar for dd-2 112. dd-2 Lv 1 1 pt. 7,002
  3. Avatar for aspadistra 113. aspadistra Lv 1 1 pt. 6,567
  4. Avatar for Rodwood 114. Rodwood Lv 1 1 pt. 6,555
  5. Avatar for Bluriv 115. Bluriv Lv 1 1 pt. 6,337
  6. Avatar for ace142 116. ace142 Lv 1 1 pt. 6,274
  7. Avatar for StanleyGucci 117. StanleyGucci Lv 1 1 pt. 6,159
  8. Avatar for larry25427 118. larry25427 Lv 1 1 pt. 6,112
  9. Avatar for ScyllaHide 119. ScyllaHide Lv 1 1 pt. 6,078
  10. Avatar for KateMoz 120. KateMoz Lv 1 1 pt. 5,678

Comments