Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for Mike Cassidy 51. Mike Cassidy Lv 1 9 pts. 9,408
  2. Avatar for joremen 52. joremen Lv 1 8 pts. 9,396
  3. Avatar for cinnamonkitty 53. cinnamonkitty Lv 1 8 pts. 9,389
  4. Avatar for alwen 54. alwen Lv 1 7 pts. 9,380
  5. Avatar for stomjoh 55. stomjoh Lv 1 7 pts. 9,362
  6. Avatar for benrh 56. benrh Lv 1 7 pts. 9,355
  7. Avatar for Marvelz 57. Marvelz Lv 1 6 pts. 9,328
  8. Avatar for Flagg65a 58. Flagg65a Lv 1 6 pts. 9,323
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 5 pts. 9,318
  10. Avatar for boondog 60. boondog Lv 1 5 pts. 9,313

Comments