Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for orily1337 61. orily1337 Lv 1 5 pts. 9,310
  2. Avatar for poiuytrewq987 62. poiuytrewq987 Lv 1 4 pts. 9,300
  3. Avatar for harvardman 63. harvardman Lv 1 4 pts. 9,291
  4. Avatar for Cagdason 64. Cagdason Lv 1 4 pts. 9,280
  5. Avatar for manu8170 65. manu8170 Lv 1 4 pts. 9,236
  6. Avatar for Hellcat6 66. Hellcat6 Lv 1 3 pts. 9,205
  7. Avatar for cbwest 67. cbwest Lv 1 3 pts. 9,194
  8. Avatar for Sydefecks 68. Sydefecks Lv 1 3 pts. 9,185
  9. Avatar for alcor29 69. alcor29 Lv 1 3 pts. 9,169
  10. Avatar for navn 70. navn Lv 1 3 pts. 9,163

Comments