Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for Altercomp 71. Altercomp Lv 1 2 pts. 9,161
  2. Avatar for Dhalion 72. Dhalion Lv 1 2 pts. 9,149
  3. Avatar for abiogenesis 73. abiogenesis Lv 1 2 pts. 9,122
  4. Avatar for fpc 74. fpc Lv 1 2 pts. 9,119
  5. Avatar for Squirrely 75. Squirrely Lv 1 2 pts. 9,112
  6. Avatar for Merf 76. Merf Lv 1 2 pts. 9,089
  7. Avatar for mitarcher 77. mitarcher Lv 1 2 pts. 9,081
  8. Avatar for ManVsYard 78. ManVsYard Lv 1 2 pts. 9,004
  9. Avatar for aheadofthefold 79. aheadofthefold Lv 1 1 pt. 8,980
  10. Avatar for yasmin_waydzik 80. yasmin_waydzik Lv 1 1 pt. 8,972

Comments