Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567

  1. Avatar for pfirth 81. pfirth Lv 1 1 pt. 8,968
  2. Avatar for Arne Heessels 82. Arne Heessels Lv 1 1 pt. 8,958
  3. Avatar for Artoria2e5 83. Artoria2e5 Lv 1 1 pt. 8,956
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 1 pt. 8,880
  5. Avatar for Knoblerine 86. Knoblerine Lv 1 1 pt. 8,754
  6. Avatar for RockOn 87. RockOn Lv 1 1 pt. 8,754
  7. Avatar for kludbrook 88. kludbrook Lv 1 1 pt. 8,751
  8. Avatar for rinze 89. rinze Lv 1 1 pt. 8,741
  9. Avatar for IHGreenman 90. IHGreenman Lv 1 1 pt. 8,736

Comments