Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709

  1. Avatar for robgee 11. robgee Lv 1 67 pts. 9,856
  2. Avatar for drumpeter18yrs9yrs 12. drumpeter18yrs9yrs Lv 1 64 pts. 9,849
  3. Avatar for reefyrob 13. reefyrob Lv 1 62 pts. 9,844
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 59 pts. 9,831
  5. Avatar for Deleted player 15. Deleted player pts. 9,828
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 54 pts. 9,781
  7. Avatar for jobo0502 17. jobo0502 Lv 1 52 pts. 9,780
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 50 pts. 9,772
  9. Avatar for silent gene 19. silent gene Lv 1 47 pts. 9,761
  10. Avatar for vakobo 20. vakobo Lv 1 45 pts. 9,749

Comments