Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709

  1. Avatar for georg137 31. georg137 Lv 1 27 pts. 9,662
  2. Avatar for Hiro Protagonist 32. Hiro Protagonist Lv 1 25 pts. 9,650
  3. Avatar for Deleted player 33. Deleted player pts. 9,643
  4. Avatar for NinjaGreg 34. NinjaGreg Lv 1 23 pts. 9,639
  5. Avatar for TastyMunchies 35. TastyMunchies Lv 1 22 pts. 9,610
  6. Avatar for SWR_DMaster 36. SWR_DMaster Lv 1 21 pts. 9,602
  7. Avatar for pvc78 37. pvc78 Lv 1 20 pts. 9,592
  8. Avatar for Blipperman 38. Blipperman Lv 1 19 pts. 9,590
  9. Avatar for frood66 39. frood66 Lv 1 18 pts. 9,589
  10. Avatar for MicElephant 40. MicElephant Lv 1 17 pts. 9,587

Comments