Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709

  1. Avatar for toshiue 101. toshiue Lv 1 1 pt. 8,437
  2. Avatar for hajtogato 102. hajtogato Lv 1 1 pt. 8,427
  3. Avatar for Museka 103. Museka Lv 1 1 pt. 8,238
  4. Avatar for dbuske 104. dbuske Lv 1 1 pt. 8,182
  5. Avatar for Dantoto 105. Dantoto Lv 1 1 pt. 8,089
  6. Avatar for MrZanav 106. MrZanav Lv 1 1 pt. 7,950
  7. Avatar for Llamaspamase 107. Llamaspamase Lv 1 1 pt. 7,886
  8. Avatar for Willyanto 108. Willyanto Lv 1 1 pt. 7,776
  9. Avatar for Fowardint 109. Fowardint Lv 1 1 pt. 7,598
  10. Avatar for benz888 110. benz888 Lv 1 1 pt. 7,252

Comments