Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709
  1. Avatar for brendana0615 121. brendana0615 Lv 1 1 pt. 5,357
  2. Avatar for choiwj2018 122. choiwj2018 Lv 1 1 pt. 4,773
  3. Avatar for StackOverflow 123. StackOverflow Lv 1 1 pt. 4,515
  4. Avatar for 01010011111 124. 01010011111 Lv 1 1 pt. 4,459
  5. Avatar for Bletchley Park 125. Bletchley Park Lv 1 1 pt. 0
  6. Avatar for Hollinas 126. Hollinas Lv 1 1 pt. 0
  7. Avatar for muratase 127. muratase Lv 1 1 pt. 0
  8. Avatar for Idiotboy 128. Idiotboy Lv 1 1 pt. 0
  9. Avatar for lamoille 129. lamoille Lv 1 1 pt. 0

Comments