Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 10,028
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,932
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,924
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,844
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 9,799
  6. Avatar for Go Science 6. Go Science 16 pts. 9,793
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,704
  8. Avatar for Russian team 8. Russian team 6 pts. 9,591
  9. Avatar for Contenders 9. Contenders 4 pts. 9,535
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,474

  1. Avatar for Fowardint 131. Fowardint Lv 1 1 pt. 7,100
  2. Avatar for drumpeter18yrs9yrs 132. drumpeter18yrs9yrs Lv 1 1 pt. 7,040
  3. Avatar for larry25427 133. larry25427 Lv 1 1 pt. 7,019
  4. Avatar for Artoria2e5 134. Artoria2e5 Lv 1 1 pt. 7,015
  5. Avatar for denmurashkin 135. denmurashkin Lv 1 1 pt. 6,992
  6. Avatar for Breanna.martin 136. Breanna.martin Lv 1 1 pt. 6,819
  7. Avatar for Cerber4444 137. Cerber4444 Lv 1 1 pt. 6,537
  8. Avatar for o.w. 138. o.w. Lv 1 1 pt. 6,475
  9. Avatar for 01010011111 139. 01010011111 Lv 1 1 pt. 6,417
  10. Avatar for adik5312 140. adik5312 Lv 1 1 pt. 6,348

Comments


vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.