Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 10,028
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,932
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,924
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,844
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 9,799
  6. Avatar for Go Science 6. Go Science 16 pts. 9,793
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,704
  8. Avatar for Russian team 8. Russian team 6 pts. 9,591
  9. Avatar for Contenders 9. Contenders 4 pts. 9,535
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,474
  1. Avatar for Psych0Active 101. Psych0Active Lv 1 1 pt. 8,071
  2. Avatar for jeremiasivan 102. jeremiasivan Lv 1 1 pt. 8,066
  3. Avatar for RyeSnake 103. RyeSnake Lv 1 1 pt. 8,058
  4. Avatar for Zainul0103 104. Zainul0103 Lv 1 1 pt. 7,939
  5. Avatar for mtksto 105. mtksto Lv 1 1 pt. 7,905
  6. Avatar for Squirrely 106. Squirrely Lv 1 1 pt. 7,897
  7. Avatar for roman madala 107. roman madala Lv 1 1 pt. 7,873
  8. Avatar for Deleted player 108. Deleted player pts. 7,869
  9. Avatar for Sydefecks 109. Sydefecks Lv 1 1 pt. 7,866
  10. Avatar for hajtogato 110. hajtogato Lv 1 1 pt. 7,807

Comments

vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.