Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 10,028
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,932
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,924
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,844
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 9,799
  6. Avatar for Go Science 6. Go Science 16 pts. 9,793
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,704
  8. Avatar for Russian team 8. Russian team 6 pts. 9,591
  9. Avatar for Contenders 9. Contenders 4 pts. 9,535
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,474
  1. Avatar for JSmith48 51. JSmith48 Lv 1 13 pts. 9,255
  2. Avatar for DoctorSockrates 52. DoctorSockrates Lv 1 13 pts. 9,212
  3. Avatar for WBarme1234 53. WBarme1234 Lv 1 12 pts. 9,202
  4. Avatar for toshiue 54. toshiue Lv 1 11 pts. 9,123
  5. Avatar for pfirth 55. pfirth Lv 1 11 pts. 9,067
  6. Avatar for petetrig 56. petetrig Lv 1 10 pts. 9,064
  7. Avatar for Hellcat6 57. Hellcat6 Lv 1 10 pts. 9,040
  8. Avatar for martin.kendig@verizon.net 58. martin.kendig@verizon.net Lv 1 9 pts. 9,025
  9. Avatar for alwen 59. alwen Lv 1 9 pts. 8,984
  10. Avatar for abiogenesis 60. abiogenesis Lv 1 8 pts. 8,980

Comments

vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.